PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G004700.1
Common NamePOPTR_0001s04190g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ERF
Protein Properties Length: 288aa    MW: 31831.4 Da    PI: 8.4762
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G004700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP2582.3e-183081255
                 AP2  2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55
                        ++ GVr+++ +g+WvAeI+d ++  ++ r +lg+f taeeAa+a+++a+  l+g
  Potri.001G004700.1 30 KFVGVRQRP-SGKWVAEIKDTTQS-QKIRMWLGTFETAEEAARAYDEAACLLRG 81
                        799******.7*********5432.47**********************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5103220.0993089IPR001471AP2/ERF domain
PfamPF008474.0E-133081IPR001471AP2/ERF domain
SMARTSM003804.7E-363095IPR001471AP2/ERF domain
CDDcd000181.13E-303091No hitNo description
SuperFamilySSF541711.24E-183090IPR016177DNA-binding domain
Gene3DG3DSA:3.30.730.102.5E-273089IPR001471AP2/ERF domain
PRINTSPR003675.0E-83142IPR001471AP2/ERF domain
PRINTSPR003675.0E-85571IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000302Biological Processresponse to reactive oxygen species
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0035865Biological Processcellular response to potassium ion
GO:0048528Biological Processpost-embryonic root development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MEYHQFQKQP GGVSHSKFKE RCSSNTSRNK FVGVRQRPSG KWVAEIKDTT QSQKIRMWLG  60
TFETAEEAAR AYDEAACLLR GSNTRTNFNT HVPSNSPVSM KIRNLLKHKK SLKQNSSATS  120
TTKSTIKTST IVSSKSSFNR SINSFLPNDS NIDSFSSSID NHSSYFNGIK QENKVFDNAY  180
RPDLSGCCIG GLEPVTSQSH PSCSLPSGFD PQLQFVQEGM WLPKNAGLLS DTSSGPELAE  240
FERMKVERQI SASLYAMNGG NEYFENANDS SDALWDLPAL CQLFCSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gcc_A7e-153192363ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00521DAPTransfer from AT5G19790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299104.10.0hypothetical protein POPTR_0001s04190g
TrEMBLB9GLE40.0B9GLE4_POPTR; Uncharacterized protein
STRINGPOPTR_0001s04190.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33413069
Representative plantOGRP6161718
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G19790.17e-31related to AP2 11